Skip to content
Domains

Religion & Spirituality .com

Create free account

Expired Religion & Spirituality domains on .com with backlinks

Updated Part of Religion & Spirituality · .com

This page lists 1,149 expired Religion & Spirituality domains on .com. Each has expired, is available to register, and has referring domains that survived the original site going offline. That is 45% of the 2,538 Religion & Spirituality listings and 1% of the 61,856 .com listings in the directory. Across the slice, the median listing here has under 10 referring domains; 1,099 carry at least one named linking source; 1,149 had their availability re-checked in the last 30 days; 185 are open, with the name already shown; 12 sit in the top band of 250 or more referring domains. Of the 1,149 with a recorded registration era, 37% were first registered in 2010 to 2014, the largest band, with registrations running from the 1995 to 1999 band to the 2025 to 2029 band. The most common linking sources are Wikipedia (895), Hacker News (98) and Carnegie Mellon University (22).

Show all domains
Show all domains
About this list

Narrowing a category to one extension is how a registrar choice or a market focus usually starts: the same topic reads differently on .com than elsewhere, and the extension decides who can register the name.

Every listing is verified the same way as the rest of the directory. Availability is re-checked against the live DNS root over DNS-over-HTTPS, and a listing that turns out to be registered is removed. Referring domains are counted from our own web crawl, not from a paid link index. Site history comes from archived captures: the archived snapshot count and the span of years the site was captured. Revised Score blends link-graph centrality, referring domains and site history into one 0 to 100 grade, computed across the whole directory.

At a glance

Cite as: “Expired Religion & Spirituality domains on .com with backlinks”, Revised, https://getrevised.com/app/expired/category/religion/tld/com. Last updated 15 November 2026. Updated continuously; free listings and paid plans show names; others masked.

As of 15 November 2026, the Revised directory of expired Religion & Spirituality domains on .com with backlinks holds 1,149 listings, each classified from its archived content. All have expired and are available to register. The median listing has under 10 referring domains, and 12 have 250 or more. Spam-flagged names are filtered out, and 1,149 (100%) had availability re-checked within 30 days. 1,099 (95%) carry a link from a tracked university, encyclopedia or news site. Referring domains come from our own web crawl. 185 (16%) are free listings: name and exact counts shown, the rest stay masked except on Starter and Business. Search and filters need no account; masked names stay masked on Free.

Listings
1,149
Free listings
185 (16%)
Median ref. domains
Under 10
Named sources
1,099 (95%)
Re-checked, 30 days
1,149 (100%)
Last updated
15 Nov 2026

Frequently asked questions

How many expired Religion & Spirituality domains on .com are listed?
1,149 at the last count. Every one has expired, is available to register, and has referring domains counted from our web crawl. The count updates as listings are added and as availability re-checks remove names that were registered.
How are these Religion & Spirituality .com listings verified?
Availability is re-checked against the live DNS root over DNS-over-HTTPS, history comes from archived captures, and referring domains are counted from our web crawl. A listing found to be registered is removed. Names are masked on Free; Starter and Business show every name, and metrics are open.
How do I narrow Religion & Spirituality .com further?
Use the filters to pivot: change the referring domain band, minimum age or Revised Score, or clear the preset to see the whole directory. Compare listings on site history before choosing one, then register the name at any registrar that offers it.

DR: Domain Rating by Ahrefs

Directory listings. Up and Down move between rows; Enter opens the listing; Right and Left move through the row’s controls.
Actions
.comReligion & Spirituality<100–9MozillaMDN Web DocsHacker NewsUnder $10015 yr.com93
sangyenyenpa.com.comReligion & Spirituality<106Wikipedia$9916 yr.com35Open
.comReligion & Spirituality<100–9WikipediaUnder $10024 yr.com66
.comReligion & Spirituality<100–9WikipediaUnder $10012 yr.com69
revelderfredasmithmcc.com.comReligion & Spirituality40Wikipedia$9919 yr.comNo AI-cited linksOpen
internationalcopticunion.com.comReligion & Spirituality30Wikipedia$9911 yr.comNo AI-cited linksOpen
.comReligion & Spirituality<100–9WikipediaUnder $10019 yr.com69
kollerupeddintiamma.com.comReligion & Spirituality30Wikipedia$9910 yr.comNo AI-cited linksOpen
holycatholicchurch-wr.com.comReligion & Spirituality40Wikipedia$9913 yr.comNo AI-cited linksOpen
.comReligion & Spirituality<100–9Hacker NewsUnder $10015 yr.com61
.comReligion & Spirituality<100–9Hacker NewsUnder $10018 yr.com66
.comReligion & Spirituality<100–9WikipediaUnder $1008 yr.com69
hoskotemission.com.comReligion & Spirituality40Wikipedia$9915 yr.comNo AI-cited linksOpen
hoimachurch.com.comReligion & Spirituality20Wikipedia$4915 yr.comNo AI-cited linksOpen
lalkitabinhindi.com.comReligion & Spirituality30Hacker News$4415 yr.comNo AI-cited linksOpen
mtahlebchurch.com.comReligion & Spirituality30Wikipedia$9915 yr.com35Open
.comReligion & Spirituality<100–9University of British ColumbiaUnder $10016 yr.com64
.comReligion & Spirituality<100–9University of EdinburghUnder $10015 yr.com64
text2inspire.com.comReligion & Spirituality30Hacker News$4914 yr.comNo AI-cited linksOpen
stthomasinternationalpilgrimcentre.com.comReligion & Spirituality30Wikipedia$9917 yr.com59Open
madivalajanasangha.com.comReligion & Spirituality30Wikipedia$4913 yr.comNo AI-cited linksOpen
ascensionparishdavao.com.comReligion & Spirituality30Wikipedia$4917 yr.comNo AI-cited linksOpen
scottmagdalein.com.comReligion & Spirituality<100Hacker News$4917 yr.com51Open
jamianaimia.com.comReligion & Spirituality30Wikipedia$9914 yr.comNo AI-cited linksOpen
.comReligion & Spirituality<100–9University of MinnesotaUnder $10028 yr.com65
thecentralorder.com.comReligion & Spirituality30Hacker News$294 yr.comNo AI-cited linksOpen
srinagavallilakshminarasimhaswamy.com.comReligion & Spirituality30Wikipedia$498 yr.comNo AI-cited linksOpen
5daystowealth.com.comReligion & Spirituality30Hacker News$1,90214 yr.comNo AI-cited linksOpen
calvarychapelironriver.com.comReligion & Spirituality30Wikipedia$9916 yr.com48Open
vishnumandiredmonton.com.comReligion & Spirituality40Wikipedia$9912 yr.comNo AI-cited linksOpen
vashikaranmantrainhindi.com.comReligion & Spirituality30Hacker News$9915 yr.comNo AI-cited linksOpen
motherantonia.com.comReligion & Spirituality30Wikipedia$4917 yr.com45Open
tabacki.com.comReligion & Spirituality20Wikipedia$9925 yr.com44Open
santamariadellacatena.com.comReligion & Spirituality30Wikipedia$9910 yr.comNo AI-cited linksOpen
urlaurpattern.com.comReligion & Spirituality31Wikipedia$9913 yr.comNo AI-cited linksOpen
londonbardogroup.com.comReligion & Spirituality20Wikipedia$4919 yr.comNo AI-cited linksOpen
thebiblestorycompany.com.comReligion & Spirituality30Wikipedia$296 yr.comNo AI-cited linksOpen
.comReligion & Spirituality<100–9WikipediaUnder $10016 yr.com69
suriyanikkarudearadhana.com.comReligion & Spirituality20Wikipedia$498 yr.comNo AI-cited linksOpen
.comReligion & Spirituality<100–9WikipediaUnder $10018 yr.com64
.comReligion & Spirituality<100–9WikipediaUnder $10016 yr.com69
abdulrashiddawoodi.com.comReligion & Spirituality20Wikipedia$274 yr.comNo AI-cited linksOpen
.comReligion & Spirituality<100–9University of OxfordUnder $10013 yr.com89
reverenddeb.com.comReligion & Spirituality30Hacker News$4915 yr.comNo AI-cited linksOpen
.comReligion & Spirituality<100–9WikipediaUnder $10010 yr.com69
nostradamusdecoded.com.comReligion & Spirituality32Wikipedia$4919 yr.com47Open
shiayateemkhaana.com.comReligion & Spirituality20Wikipedia$4917 yr.comNo AI-cited linksOpen
davidwgraves.com.comReligion & Spirituality30Wikipedia$9910 yr.comNo AI-cited linksOpen
.comReligion & Spirituality<100–9WikipediaUnder $10017 yr.com69
psychicsatx.com.comReligion & Spirituality20Hacker News$4915 yr.com36Open
951–1,000 of 1,148